General Information

  • ID:  hor006647
  • Uniprot ID:  P70074
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  gnrh1
  • Organism:  Pagrus major (Red sea bream) (Chrysophrys major)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pagrus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DLDSLSDTLGDIIERFPHADSPCSVLGCAEEPPFPKMYRMKGFIGSGTDRDNGHRTYKK
  • Length:  59
  • Propeptide:  MAPQTSNLWLLLVVMMVMSQGCCQHWSYGLSPGGKRDLDSLSDTLGDIIERFPHADSPCSVLGCAEEPPFPKMYRMKGFIGSGTDRDNGHRTYKK
  • Signal peptide:  MAPQTSNLWLLLVVMMVMSQGCC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P70074-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006647_AF2.pdbhor006647_ESM.pdb

Physical Information

Mass: 760808 Formula: C285H442N80O91S4
Absent amino acids: QW Common amino acids: DG
pI: 5.61 Basic residues: 10
Polar residues: 19 Hydrophobic residues: 13
Hydrophobicity: -74.41 Boman Index: -14036
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.58
Instability Index: 4780.68 Extinction Coefficient cystines: 3105
Absorbance 280nm: 53.53

Literature

  • PubMed ID:  NA
  • Title:  NA